PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc10_g03290
Common NameGSCOC_T00024852001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family BES1
Protein Properties Length: 334aa    MW: 35459.8 Da    PI: 9.2154
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc10_g03290genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822206.66.8e-64371663133
       DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslks 100
                  ++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve DGttyrkg++p+   e++ +sa+++p+ss + s+ s
  Cc10_g03290  37 GRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVESDGTTYRKGCRPP-PIEIGSTSANITPSSSRNPSPPS 133
                  79************************************************************************.9********************** PP

       DUF822 101 salaspvesysaspksssfpspssldsislasa 133
                  s++asp++sy++sp sss psp++ + ++++++
  Cc10_g03290 134 SYFASPIPSYQPSPLSSSCPSPTRQEPNMASHP 166
                  ************************999987654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.2E-6037162IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MMWEAGGSTA SSSAAGGSGG GGGGGGEGGG SGGVVNGRRK PSWRERENNR RRERRRRAIA  60
AKIYAGLRAQ GNYNLPKHCD NNEVLKALCA EAGWIVESDG TTYRKGCRPP PIEIGSTSAN  120
ITPSSSRNPS PPSSYFASPI PSYQPSPLSS SCPSPTRQEP NMASHPFAFL RNSIPSSLPP  180
LRISNSAPVT PPLSSPTRLP KQIFNLEALA KESMNALNIP FFAASAPASP TRGQRFTPAT  240
IPECDESDSS TIDSGQWMNF QTYAPNMVPT SPTFNLMKPM AQPVSPMDVV SGKGKGIEFD  300
FEKLPVKAWE GERIHEVGLD DLELTLGSGN ARI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11730SGGGGGGGGEGGGS
23756RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016463430.11e-163PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-117BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH770.0A0A068UH77_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-152(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.24e-84BES1 family protein